Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)
Uniprot NO.:Q44906
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTAGHILYLIRISIENIIILSAPMLIIALIVGLLISIFQAITSIQDQTLSFIPKIIVILL VIVIFGPWILNKLMQFTYMIFSQLQNV
Protein Names:Recommended name: Flagellar biosynthetic protein FliQ
Gene Names:Name:fliQ Ordered Locus Names:BB_0274
Expression Region:1-87
Sequence Info:full length protein