Recombinant Borrelia burgdorferi ATP-dependent Clp protease proteolytic subunit 2(clpP2)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Borrelia burgdorferi ATP-dependent Clp protease proteolytic subunit 2(clpP2)

CSB-EP528713BUD
Regular price
$870.00 USD
Sale price
$870.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: O51698

Gene Names: clpP2

Organism: Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)

AA Sequence: MTGKEDNDACVLHDKSLKLVLKSRSIVIAGEITKDVSRLFQEKILLLEALDFKKPIFVYIDSEGGDIDAGFAIFNMIRFVKPKVFTVGVGLVASAAALIFLAAKLENRFSLPFARYLLHQPLSGFKGVATDIEIYTNELNKVKKELNNIISKETGQKISKIEKDTDRDFWLDSSAAKKYGLVFEVVETKYQLEEFISA

Expression Region: 1-198aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW: 27.2 kDa

Alternative Name(s): Endopeptidase Clp 2

Relevance: Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Reference: "Genomic sequence of a Lyme disease spirochaete, Borrelia burgdorferi." Fraser C.M., Casjens S., Huang W.M., Sutton G.G., Clayton R.A., Lathigra R., White O., Ketchum K.A., Dodson R.J., Hickey E.K., Gwinn M.L., Dougherty B.A., Tomb J.-F., Fleischmann R.D., Richardson D.L., Peterson J.D., Kerlavage A.R., Quackenbush J. Venter J.C. Nature 390:580-586(1997)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share