![Recombinant Bartonella henselae Lipoyl synthase(lipA)](http://www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_f2b971a1-fbe4-45cb-80fb-3c2d38672ab3_{width}x.jpg?v=1659200707)
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: Q6G401
Gene Names: lipA
Organism: Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) (Rochalimaea henselae)
AA Sequence: MVTVVDRVTDRRLRHPEKAHRPDTSVQKKPDWIRVKAPTSQVYKETHGIVRAHKLVTVCEEAGCPNIGECWSQRHASFMILGEICTRACAFCNVATGIPFAVDENEPERVADAVARMELKHVVITSVDRDDLADGGAEHFAKVIYAIRRKAPKTTIEVLTPDFRHKDGALEIVVAAKPDVFNHNLETVPSKYLKVRPGARYFHSIRLLQRVKELDPTIFTKSGIMVGLGEERNEILQLMDDLRSADVDFMTIGQYLQPTRKHHPVIRFVPPEEFESFAKIGKVKGFLHMASNPLTRSSHHAGDDFAILQKARDEKFALQR
Expression Region: 1-320aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 10xHis-tagged
MW: 38.7 kDa
Alternative Name(s): Lip-syn
Relevance: Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.
Reference: "The louse-borne human pathogen Bartonella quintana is a genomic derivative of the zoonotic agent Bartonella henselae." Alsmark U.C.M., Frank A.C., Karlberg E.O., Legault B.-A., Ardell D.H., Canbaeck B., Eriksson A.-S., Naeslund A.K., Handley S.A., Huvet M., La Scola B., Holmberg M., Andersson S.G.E. Proc. Natl. Acad. Sci. U.S.A. 101:9716-9721(2004)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.