Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Uniprot NO.:Q75EU0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSFYTVVATFLSVVLASAVFWVLAPKENQTVWRSTIILSMSMMFLMWAVTYLSQLHPLVV PRRSDLRPEFAE
Protein Names:Recommended name: V-type proton ATPase subunit e Short name= V-ATPase subunit e Alternative name(s): Vacuolar proton pump subunit e
Gene Names:Name:VMA9 Ordered Locus Names:AAL005W
Expression Region:1-72
Sequence Info:full length protein