
Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Others
Uniprot ID:Q32ZE1
Gene Names:N/A
Organism:Zika virus (ZIKV)
AA Sequence:KSVDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEEDGPPMRGGGGSGGGGSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQLLAVPPGERARNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKR
Expression Region:1415-1463aa+GGGGSGGGG+1499-1668aa
Sequence Info:Partial
Source:E.coli
Tag Info:N-terminal 6xHis-tagged
MW:28.2 kDa
Alternative Name(s):
Relevance:Serine protease subunit NS2B: Required cofactor for the serine protease function of NS3.
Reference:"Crystal structure of unlinked NS2B-NS3 protease from Zika virus." Zhang Z., Li Y., Loh Y.R., Phoo W.W., Hung A.W., Kang C., Luo D. Science 354:1597-1600(2016)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:13-23 business days
You may also like
-
Recombinant Ross river virus Structural polyprotein,partial
- Regular price
- $2,587.00 USD
- Sale price
- $2,587.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Transmembrane protease serine 11A(TMPRSS11A),partial
- Regular price
- $1,720.00 USD
- Sale price
- $1,720.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant WU polyomavirus Major capsid protein VP1
- Regular price
- $892.00 USD
- Sale price
- $892.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Zinc finger and SCAN domain-containing protein 1(ZSCAN1)
- Regular price
- $1,720.00 USD
- Sale price
- $1,720.00 USD
- Regular price
-
- Unit price
- per
Sold out