Recombinant Vibrio vulnificus Fe-S biogenesis protein NfuA(nfuA)

Recombinant Vibrio vulnificus Fe-S biogenesis protein NfuA(nfuA)

CSB-EP813457VFIe1
Regular price
$743.00 USD
Sale price
$743.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Microbiology

Target / Protein: nfuA

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Vibrio vulnificus (strain CMCP6)

Delivery time: 3-7 business days

Uniprot ID: Q8DDU2 

AA Sequence: MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDELSLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY

Tag info: NO-tagged

Expression Region: 1-194aa

Protein length: Full Length

MW: 21.0 kDa

Alternative Name(s):

Relevance: Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins.

Reference: "Complete genome sequence of Vibrio vulnificus CMCP6." Rhee J.H., Kim S.Y., Chung S.S., Kim J.J., Moon Y.H., Jeong H., Choy H.E. Submitted (DEC-2002)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share