Recombinant Schmidtea mediterranea Activin 2,partial

Recombinant Schmidtea mediterranea Activin 2,partial

CSB-EP3606GOQ1
Regular price
$883.00 USD
Sale price
$883.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Others

Uniprot ID:U3RAB9

Gene Names:N/A

Organism:Schmidtea mediterranea (Freshwater planarian flatworm)

AA Sequence:NPVERKSSVYNDNAEEKIIQKDSFKDKVINDLKSKILQKLNLKEAPKFNSSFDWSSMTEQIRSAALRLGVPFDETTENSQPTSESMIISLTKVNHCIDNSTNNQHCYDLTIPNMDNKILVGANFIIQFLPLAFERTVEDNIIYNITINNLPETVYSFSVAQLKSNSLYIAYTNILKTLLDNQRMSHSTFSFTVSISGDEQTTKLERMIDIENIVIELEYQVLPTPVRKRRDAGNTCIPNTYFCCTQTLKVGIDELGWSQFIFAPTTFTINYCRGDCNSYLTFSSNHARALNFARGRGLGSNKDLRACCVPYSYSSLTIMYLNNENALEVSTFNDLIAATCGCM

Expression Region:64-406aa

Sequence Info:Partial

Source:E.coli

Tag Info:N-terminal 6xHis-tagged

MW:42.9 kDa

Alternative Name(s):Activin 2(Fragment)

Relevance:

Reference:"Tissue absence initiates regeneration through Follistatin-mediated inhibition of Activin signaling." Gavino M.A., Wenemoser D., Wang I.E., Reddien P.W. Elife 2:E00247-E00247(2013)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:13-23 business days

You may also like

  • Recombinant Hordeum vulgare Betaine aldehyde dehydrogenase, partial
    Regular price
    $883.00 USD
    Sale price
    $883.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Arabidopsis thaliana Pentatricopeptide repeat-containing protein At3g42630(At3g42630)
    Regular price
    $883.00 USD
    Sale price
    $883.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Chlamydia trachomatis Putative zinc metalloprotease CT_072 (CT_072)
    Regular price
    $1,674.00 USD
    Sale price
    $1,674.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Putative methyl-accepting chemotaxis protein yoaH(yoaH)
    Regular price
    $1,623.00 USD
    Sale price
    $1,623.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share