Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Developmental Biology
Uniprot ID:P07490
Gene Names:Gnrh1
Organism:Rattus norvegicus (Rat)
AA Sequence:QHWSYGLRPGGKRNTEHLVDSFQEMGKEEDQMAEPQNFECTVHWPRSPLRDLRGALERLIEEEAGQKKM
Expression Region:24-92aa
Sequence Info:Full Length of Mature Protein
Source:E.coli
Tag Info:N-terminal 6xHis-tagged
MW:12.2 kDa
Alternative Name(s):Progonadoliberin-1(Progonadoliberin I) [Cleaved into: Gonadoliberin-1(Gonadoliberin I)(Gonadotropin-releasing hormone I)(GnRH-I)(Luliberin I)(Luteinizing hormone-releasing hormone I)(LH-RH I); Prolactin release-inhibiting factor 1(Prolactin release-inhibiting factor I)]
Relevance:Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.
Reference:"Adhesion-related kinase repression of gonadotropin-releasing hormone gene expression requires Rac activation of the extracellular signal-regulated kinase pathway." Allen M.P., Xu M., Linseman D.A., Pawlowski J.E., Bokoch G.M., Heidenreich K.A., Wierman M.E. J Biol Chem 277:38133-38140(2002)
Purity:Greater than 90% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:3-7 business days