Recombinant Rat Complement factor D (Cfd)

Recombinant Rat Complement factor D (Cfd)

CSB-MP005271RA
Regular price
$510.00 USD
Sale price
$510.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 20ug

Updated Date: Stock Protein updated on 20170405

Research areas: Immunology

Target / Protein: Cfd

Biologically active: Not Tested

Expression system: Mammalian cell

Species of origin: Rattus norvegicus (Rat)

Delivery time: 3-7 business days

Uniprot ID: P32038

AA Sequence: ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVNVTA

Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 26-263aa

Protein length: Full Length of Mature Protein

MW: 29.8 kDa

Alternative Name(s): Adipsin C3 convertase activator Endogenous vascular elastase Properdin factor D

Relevance: Factor D cleaves factor B when the latter is complexed with factor C3b, activating the C3bbb complex, which then becomes the C3 convertase of the alternate pathway. Its function is homologous to that of C1s in the classical pathway.

Reference: "Purification and partial characterization of rat factor D."Baker B.C., Campbell C.J., Grinham C.J., Turcatti G.Biochem. J. 279:775-779(1991)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share