
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Others
Target / Protein: AFP2
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Raphanus sativus (Radish)
Delivery time: 3-7 business days
Uniprot ID: P30230
AA Sequence: QKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 30-80aa
Protein length: Full Length
MW: 21.7 kDa
Alternative Name(s): Cysteine-rich antifungal protein 2 Short name: AFP2 Short name: RAFP2
Relevance: Possesses antifungal activity sensitive to inorganic cations. Induces potential changes in fungal membranes and increased K+ efflux and Ca2+ uptake.
Reference: "Mutational analysis of a plant defensin from radish (Raphanus sativus L.) reveals two adjacent sites important for antifungal activity." De Samblanx G.W., Goderis I.J., Thevissen K., Raemaekers R., Fant F., Borremans F., Acland D.P., Osborn R.W., Patel S., Broekaert W.F. J. Biol. Chem. 272:1171-1179(1997).
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Raphanus sativus Defensin-like protein 2(AFP2)
- Regular price
- $896.00 USD
- Sale price
- $896.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Antifungal protein(afp)
- Regular price
- $896.00 USD
- Sale price
- $896.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Avena sativa Endochitinase
- Regular price
- $762.00 USD
- Sale price
- $762.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Dahlia merckii Defensin-like protein 1
- Regular price
- $896.00 USD
- Sale price
- $896.00 USD
- Regular price
-
- Unit price
- per
Sold out