
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Others
Target / Protein: G
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Rabies virus (strain PM) (RABV)
Delivery time: 3-7 business days
Uniprot ID: A3RM22
AA Sequence: KFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVKTTKESLVIISPSVADLDPYDKSLHSRVFPSGKCSGITISSTYCSTNHDYTIWMPENPRLGTSCDIFTNSRGKRASKGGKTCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSDETKWCPPDQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMATKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLRVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLQQHMELLESSVIPLMHPLADPSTVFKDGDEAEDFVEVHLPDVHKQISGVDLGLPSWGKY
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 20-459aa
Protein length: Partial
MW: 65.4 kDa
Alternative Name(s):
Relevance: Attaches the virus to host cellular receptor, inducing endocytosis of the virion. In the endosome, the acidic pH induces conformational changes in the glycoprotein trimer, which trigger fusion between virus and cell membrane. There is convincing in vitro evidence that the muscular form of the nicotinic acetylcholine receptor (nAChR), the neuronal cell adhesion molecule (NCAM), and the p75 neurotrophin receptor (p75NTR) bind glycoprotein and thereby facilitate rabies virus entry into cells (By similarity).
Reference: "Complete nucleotide sequencing of an Indian isolate of Rabies virus."Desai A., Nagaraja T., Muhamuda K., Madhusudana S., Ravi V.
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Rabies virus Glycoprotein G(G), partial
- Regular price
- $896.00 USD
- Sale price
- $896.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rabies virus Glycoprotein(G),partial
- Regular price
- $896.00 USD
- Sale price
- $896.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rabies virus Glycoprotein(G),partial
- Regular price
- $982.00 USD
- Sale price
- $982.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rabies virus Glycoprotein(G),partial
- Regular price
- $492.00 USD
- Sale price
- $492.00 USD
- Regular price
-
- Unit price
- per
Sold out