
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: Metabolism
Target / Protein:
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Plasmodium berghei (strain Anka)
Delivery time: 3-7 business days
Uniprot ID: Q7SI97
AA Sequence: MAPKAKIVLVGSGMIGGVMATLIVQKNLGDVVMFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLKDADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIVGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDQELDAIFDRTINTALEIVNLHASPYVAPAAAIIEMAESYIRDLRKVLICSTLLEGQYGHKDIFAGTPLVIGGNGVEQVIELQLNADEKKKFDEAVAETSRMKALI
Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 1-316aa
Protein length: Full Length
MW: 39.4 kDa
Alternative Name(s):
Relevance:
Reference: "Crystal structure of Plasmodium berghei lactate dehydrogenase indicates the unique structural differences of these enzymes are shared across the Plasmodium genus." Winter V.J., Cameron A., Tranter R., Sessions R.B., Brady R.L. Mol. Biochem. Parasitol. 131:1-10(2003)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Plasmodium berghei L-lactate dehydrogenase(PB000185.00.0)
- Regular price
- $908.00 USD
- Sale price
- $908.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human L-lactate dehydrogenase A chain(LDHA),partial
- Regular price
- $778.00 USD
- Sale price
- $778.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human L-lactate dehydrogenase A chain(LDHA),partial
- Regular price
- $867.00 USD
- Sale price
- $867.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Plasmodium Uncharacterized protein(berghei PBANKA_093100),partial
- Regular price
- $700.00 USD
- Sale price
- $700.00 USD
- Regular price
-
- Unit price
- per
Sold out