
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Others
Target / Protein: EPO
Biologically active: Not Tested
Expression system: Yeast
Species of origin: Sus scrofa (Pig)
Delivery time: 3-7 business days
Uniprot ID: P49157
AA Sequence: APPRLICDSRVLERYILEAKEGENATMGCAESCSFSENITVPDTKVNFYAWKRMEVQQQAMEVWQGLALLSEAILQGQALLANSSQPSEALQLHVDKAVSGLRSLTSLLRALGAQKEAIPLPDASPSSATPLRTFAVDTLCKLFRNYSNFLRGKLTLYTGEACRRRDR
Tag info: N-terminal 6xHis-tagged
Expression Region: 27-194aa
Protein length: Full Length
MW: 20.6 kDa
Alternative Name(s):
Relevance: Erythropoietin is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass.
Reference: The porcine erythropoietin gene cDNA sequence, genomic sequence and expression analyses in piglets.David R.B., Blom A.K., Sjaastad O.V., Harbitz I.Domest. Anim. Endocrinol. 20:137-147(2001)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.