
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q862Z7
Gene Names: LTB
Organism: Pan troglodytes (Chimpanzee)
AA Sequence: QDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVGYRGRTPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG
Expression Region: 49-244aa
Sequence Info: Extracellular Domain
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 24.8 kDa
Alternative Name(s): Tumor necrosis factor C ;TNF-CTumor necrosis factor ligand superfamily member 3
Relevance: Cytokine that binds to LTBR/TNFRSF3. May play a specific role in immune response regulation. Provides the mbrane anchor for the attachment of the heterotrimeric complex to the cell surface .
Reference: Rapid evolution of major histocompatibility complex class I genes in primates generates new disease alleles in humans via hitchhiking diversity.Shiina T., Ota M., Shimizu S., Katsuyama Y., Hashimoto N., Takasu M., Anzai T., Kulski J.K., Kikkawa E., Naruse T., Kimura N., Yanagiya K., Watanabe A., Hosomichi K., Kohara S., Iwamoto C., Umehara Y., Meyer A. , Wanner V., Sano K., Macquin C., Ikeo K., Tokunaga K., Gojobori T., Inoko H., Bahram S.Genetics 173:1555-1570(2006)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Pan troglodytes Lymphotoxin-beta(LTB),partial
- Regular price
- $888.00 USD
- Sale price
- $888.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Pan troglodytes Acid ceramidase(ASAH1)
- Regular price
- $756.00 USD
- Sale price
- $756.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Lymphotoxin-alpha(Lta)
- Regular price
- $756.00 USD
- Sale price
- $756.00 USD
- Regular price
-
- Unit price
- per
Sold out -
LTB Antibody - Cat. #: CSB-PA771253LA01EQV
- Regular price
- $360.00 USD
- Sale price
- $360.00 USD
- Regular price
-
- Unit price
- per
Sold out