
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q60710
Gene Names: SAMHD1
Organism: Mus musculus (Mouse)
AA Sequence: DIMITDAFLKADPYVEITGTAGKKFRISTAIDDMEAFTKLTDNIFLEVLHSTDPQLSEAQSILRNIECRNLYKYLGETQPKREKIRKEEYERLPQEVAKAKPEKAPDVELKAEDFIVDVINVDYGMEDKNPIDRVHFYCKSNSKQAVRINKEQVSQLLPEKFAEQLIRVYCKKKDGKSLDAAGKHFVQWCALRDFTKPQDGDIIAPLITPLKWNNKTSSCLQEVSKVKTCLK
Expression Region: 395-626aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 30.6 kDa
Alternative Name(s): Interferon-gamma-inducible protein Mg11SAM domain and HD domain-containing protein 1
Relevance: Host restriction nuclease that blocks early-stage virus replication in dendritic and other myeloid cells. Likewise, suppresses LINE-1 retrotransposon activity. May function by reducing the cellular dNTP levels to levels too low for retroviral reverse transcription to occur. May play a role in mediating proinflammatory responses to TNF-alpha signaling .
Reference: Mutations involved in Aicardi-Goutieres syndrome implicate SAMHD1 as regulator of the innate immune response.Rice G.I., Bond J., Asipu A., Brunette R.L., Manfield I.W., Carr I.M., Fuller J.C., Jackson R.M., Lamb T., Briggs T.A., Ali M., Gornall H., Couthard L.R., Aeby A., Attard-Montalto S.P., Bertini E., Bodemer C., Brockmann K. , Brueton L.A., Corry P.C., Desguerre I., Fazzi E., Cazorla A.G., Gener B., Hamel B.C.J., Heiberg A., Hunter M., van der Knaap M.S., Kumar R., Lagae L., Landrieu P.G., Lourenco C.M., Marom D., McDermott M.F., van der Merwe W., Orcesi S., Prendiville J.S., Rasmussen M., Shalev S.A., Soler D.M., Shinawi M., Spiegel R., Tan T.Y., Vanderver A., Wakeling E.L., Wassmer E., Whittaker E., Lebon P., Stetson D.B., Bonthron D.T., Crow Y.J.Nat. Genet. 41:829-832(2009)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Protein AATF(AATF),partial
- Regular price
- $586.00 USD
- Sale price
- $586.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Interferon-induced helicase C domain-containing protein 1(IFIH1),partial
- Regular price
- $749.00 USD
- Sale price
- $749.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human E3 ubiquitin-protein ligase TRIM11(TRIM11),partial
- Regular price
- $586.00 USD
- Sale price
- $586.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Interferon-induced helicase C domain-containing protein 1(IFIH1) ,partial
- Regular price
- $749.00 USD
- Sale price
- $749.00 USD
- Regular price
-
- Unit price
- per
Sold out