
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: others
Target / Protein: Plbd2
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Mus musculus (Mouse)
Delivery time: 3-7 business days
Uniprot ID: Q3TCN2
AA Sequence: LPTLGPGWQRQNPDPPVSRTRSLLLDAASGQLRLEDGFHPDAVAWANLTNAIRETGWAYLDLSTNGRYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFTIKPLGFLLLQISGDLEDLEPALNKTNTKPSLGSGSCSALIKLLPGGHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLVAGNNLVFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGCVLEWIRNVVANRLALDGATWADVFKRFNSGTYNNQWMIVDYKAFLPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFETVFNASGLQALVAQYGDWFSYTKNPRAKIFQRDQSLVEDMDAMVRLMRYNDFLHDPLSLCEACNPKPNAENAISARSDLNPANGSYPFQALHQRAHGGIDVKVTSFTLAKYMSMLAASGPTWDQCPPFQWSKSPFHSMLHMGQPDLWMFSPIRVPWD
Tag info: N-terminal 6xHis-tagged
Expression Region: 47-594aa
Protein length: Full Length of Mature Protein
MW: 65.9 kDa
Alternative Name(s): 66.3 kDa protein 76 kDa protein
Relevance: Putative phospholipase.
Reference: "Biochemical characterization and lysosomal localization of the mannose-6-phosphate protein p76 (hypothetical protein LOC196463)." Jensen A.G., Chemali M., Chapel A., Kieffer-Jaquinod S., Jadot M., Garin J., Journet A. Biochem. J. 402:449-458(2007)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse Putative phospholipase B-like 2(Plbd2)
- Regular price
- $744.00 USD
- Sale price
- $744.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Putative phospholipase B-like 2(Plbd2)
- Regular price
- $747.00 USD
- Sale price
- $747.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rat Putative phospholipase B-like 2(Plbd2)
- Regular price
- $747.00 USD
- Sale price
- $747.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rat Putative phospholipase B-like 2(Plbd2)
- Regular price
- $747.00 USD
- Sale price
- $747.00 USD
- Regular price
-
- Unit price
- per
Sold out