Recombinant Mouse Pro-neuropeptide Y(Npy),partial

Recombinant Mouse Pro-neuropeptide Y(Npy),partial

CSB-YP016034MO
Regular price
$991.00 USD
Sale price
$991.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Neuroscience

Uniprot ID:P57774

Gene Names:Npy

Organism:Mus musculus (Mouse)

AA Sequence:YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY

Expression Region:29-64aa

Sequence Info:Partial

Source:Yeast

Tag Info:N-terminal hFc-tagged

MW:30.9 kDa

Alternative Name(s):Pro-neuropeptide Y [Cleaved into: Neuropeptide Y(Neuropeptide tyrosine)(NPY); C-flanking peptide of NPY(CPON)]

Relevance:NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.

Reference:"Behavioral characterization of neuropeptide Y knockout mice." Bannon A.W., Seda J., Carmouche M., Francis J.M., Norman M.H., Karbon B., McCaleb M.L. Brain Res 868:79-87(2000)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:25-35 business days

Your list is ready to share