Recombinant Mouse Muellerian-inhibiting factor(Amh) ,partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Mouse Muellerian-inhibiting factor(Amh) ,partial

CSB-EP001666MO
Regular price
$743.00 USD
Sale price
$743.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: others

Target / Protein: Amh

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Mus musculus (Mouse)

Delivery time: 3-7 business days

Uniprot ID: P27106

AA Sequence: DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC

Tag info: NO-tagged

Expression Region: 450-552aa

Protein length: Partial

MW: 11.3 kDa

Alternative Name(s): Anti-Muellerian hormone

Relevance: This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin.

Reference: "The genes for a spliceosome protein (SAP62) and the anti-Mullerian hormone (AMH) are contiguous." Dresser D.W., Hacker A., Lovell-Badge R., Guerrier D. Hum. Mol. Genet. 4:1613-1618(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share