
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Epigenetics and Nuclear Signaling
Target / Protein: Nkx3-2
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Mus musculus (Mouse)
Delivery time: 3-7 business days
Uniprot ID: P97503
AA Sequence: MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSLLASPARTRTAVGQSAESPGGWDSDSALSEENEGRRRCADVPGASGTGRARVTLGLDQPGCELHAAKDLEEEAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVPGLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ
Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 1-333aa
Protein length: Full Length
MW: 40.2 kDa
Alternative Name(s): Bagpipe homeobox protein homolog 1 Homeobox protein NK-3 homolog B
Relevance: Transcriptional repressor that acts as a negative regulator of chondrocyte maturation. PLays a role in distal stomach development; required for proper antral-pyloric morphogenesis and development of antral-type epithelium. In concert with GSC, defines the structural components of the middle ear; required for tympanic ring and gonium development and in the regulation of the width of the malleus.
Reference: "Bapx1: an evolutionary conserved homologue of the Drosophila bagpipe homeobox gene is expressed in splanchnic mesoderm and the embryonic skeleton." Tribioli C., Frasch M., Lufkin T. Mech. Dev. 65:145-162(1997)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse Homeobox protein Nkx-3.2(Nkx3-2)
- Regular price
- $755.00 USD
- Sale price
- $755.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Homeobox protein Nkx-3.2(Nkx3-2)
- Regular price
- $755.00 USD
- Sale price
- $755.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Homeobox protein Nkx-3.2(Nkx3-2)
- Regular price
- $760.00 USD
- Sale price
- $760.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Homeobox protein Nkx-2.1(NKX2-1)
- Regular price
- $709.00 USD
- Sale price
- $709.00 USD
- Regular price
-
- Unit price
- per
Sold out