Recombinant Mouse Glucagon-like peptide 1 receptor(Glp1r),partial

Recombinant Mouse Glucagon-like peptide 1 receptor(Glp1r),partial

CSB-EP009514MO1-GB
Regular price
$739.00 USD
Sale price
$739.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Neuroscience

Target / Protein: Glp1r

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Mus musculus (Mouse)

Delivery time: 3-7 business days

Uniprot ID: O35659

AA Sequence: GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 22-145aa

Protein length: Extracellular Domain

MW: 30.4 kDa

Alternative Name(s): Short name: GLP-1 receptor Short name: GLP-1-R Short name: GLP-1R

Relevance: This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

Reference: "Mouse pancreatic beta-cells exhibit preserved glucose competence after disruption of the glucagon-like peptide-1 receptor gene."Flamez D., van Breusegem A., Scrocchi L.A., Quartier E., Pipeleers D., Drucker D.J., Schuit F.Diabetes 47:646-652(1998)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share