Recombinant Marmota monax Interferon gamma(IFNG)

Recombinant Marmota monax Interferon gamma(IFNG)

CSB-YP011050MQG-GB
Regular price
$997.00 USD
Sale price
$997.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Stem Cells

Target / Protein: IFNG

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Marmota monax (Woodchuck)

Delivery time: 3-7 business days

Uniprot ID: O35735

AA Sequence: QDTVNKEIEDLKGYFNASNSNVSDGGSLFLDILDKWKEESDKKVIQSQIVSFYFKLFEHLKDNKIIQRSMDTIKGDLFAKFFNSSTNKLQDFLKVSQVQVNDLKIQRKAVSELKKVMNDLLPHSTLRKRKRSQSSIRGRRASK

Tag info: N-terminal 6xHis-tagged

Expression Region: 24-166aa

Protein length: Full Length

MW: 18.6 kDa

Alternative Name(s): Short name: IFN-gamma

Relevance: Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.

Reference: "Molecular cloning of the woodchuck cytokines: TNF-alpha, IFN-gamma, and IL-6."Lohrengel B., Lu M., Roggendorf M.Immunogenetics 47:332-335(1998)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Marmota monax Interferon gamma(IFNG)
    Regular price
    $996.00 USD
    Sale price
    $996.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Marmota monax Interferon gamma(IFNG)
    Regular price
    $908.00 USD
    Sale price
    $908.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Interferon gamma(IFNG)
    Regular price
    $877.00 USD
    Sale price
    $877.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Sheep Interferon gamma(IFNG)
    Regular price
    $996.00 USD
    Sale price
    $996.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share