
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Others
Target / Protein: ZG16B
Biologically active: Not Tested
Expression system: Yeast
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: Q96DA0
AA Sequence: GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR
Tag info: N-terminal 6xHis-tagged
Expression Region: 53-208aa
Protein length: Full Length
MW: 19.2 kDa
Alternative Name(s):
Relevance:
Reference: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Zymogen granule protein 16 homolog B(ZG16B)
- Regular price
- $764.00 USD
- Sale price
- $764.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Zymogen granule protein 16 homolog B(ZG16B)
- Regular price
- $867.00 USD
- Sale price
- $867.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Protein FAM167A(FAM167A)
- Regular price
- $527.00 USD
- Sale price
- $527.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Claudin-6(CLDN6),partial
- Regular price
- $691.00 USD
- Sale price
- $691.00 USD
- Regular price
-
- Unit price
- per
Sold out