
Size:100ug. Other sizes are also available. Please contact us.
Research Areas:Cancer
Uniprot NO.:P28908
Uniprot Entry Name:
Gene Names:TNFRSF8
Species:Homo sapiens (Human)
Source:Mammalian cell
Expression Region:19-379aa
Sequence:FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK
Protein Description:Partial
Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight:43.5
Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized CD30 at 5 ?g/ml can bind human CD30L?CSB-MP023996HU1c9?, the EC50 is 14.96-20.25 ng/ml.
Purity:Greater than 95% as determined by SDS-PAGE.
Endotoxin:Less than 1.0 EU/ug as determined by LAL method.
Form:Lyophilized powder
Buffer:Lyophilized from a 0.2 ?m filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:
Relevance:
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
You may also like
-
Recombinant Human Tumor necrosis factor receptor superfamily member 11B(TNFRSF11B) (Active)
- Regular price
- $448.00 USD
- Sale price
- $448.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Tumor necrosis factor receptor superfamily member 8(TNFRSF8)
- Regular price
- $1,603.00 USD
- Sale price
- $1,603.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Cytokine receptor common subunit beta(CSF2RB),partial (Active)
- Regular price
- $363.00 USD
- Sale price
- $363.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Tumor necrosis factor receptor superfamily member 9(TNFRSF9),partial (Active)
- Regular price
- $325.00 USD
- Sale price
- $325.00 USD
- Regular price
-
- Unit price
- per
Sold out