Size:100ug. Other sizes are also available. Please contact us.
Research Areas:Signal Transduction
Uniprot NO.:P19438
Uniprot Entry Name:
Gene Names:TNFRSF1A
Species:Homo sapiens (Human)
Source:Mammalian cell
Expression Region:22-211aa
Sequence:IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT
Protein Description:Partial
Tag Info:C-terminal hFc-tagged
Mol. Weight:50.1
Biological_Activity:?Measured by its binding ability in a functional ELISA. Immobilized TNF-? (CSB-YP023955HU) at 5 ?g/ml can bind human TNFR1, the EC50 is 7.799-10.90 ng/ml.?Measured by its binding ability in a functional ELISA. Immobilized LTA(CSB-MP013218HU) at 5 ?g/ml can bind human TNFR1, the EC50 is 4.409-6.797 ng/ml.
Purity:Greater than 94% as determined by SDS-PAGE.
Endotoxin:Less than 1.0 EU/ug as determined by LAL method.
Form:Lyophilized powder
Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:
Relevance:
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link: