Recombinant Human Tumor necrosis factor receptor superfamily member 17(TNFRSF17),partial (Active)

Recombinant Human Tumor necrosis factor receptor superfamily member 17(TNFRSF17),partial (Active)

CSB-MP023974HU1
Regular price
$442.00 USD
Sale price
$442.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Cancer

Uniprot NO.:Q02223

Uniprot Entry Name:

Gene Names:Tnfrsf17

Species:Homo sapiens (Human)

Source:Mammalian cell

Expression Region:1-54aa

Sequence:MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

Protein Description:Partial

Tag Info:C-terminal hFc-tagged

Mol. Weight:34.8 kDa

Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized BCMA at 2 ?g/ml can bind Anti-BCMA recombinant antibody, the EC50 of human BCMA protein is 1.912-2.488 ng/ml.

Purity:Greater than 90% as determined by SDS-PAGE.

Endotoxin:Less than 1.0 EU/ug as determined by LAL method.

Form:Lyophilized powder

Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:B-cell maturation protein (CD_antigen: CD269)

Relevance:Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity.

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Your list is ready to share