Size:100ug. Other sizes are also available. Please contact us.
Research Areas:Immunology
Uniprot NO.:Q9UNG2
Uniprot Entry Name:
Gene Names:TNFSF18
Species:Homo sapiens (Human)
Source:Mammalian cell
Expression Region:72-199aa
Sequence:QLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS
Protein Description:Partial
Tag Info:N-terminal hFc-Flag-tagged
Mol. Weight:42.8
Biological_Activity:?Measured by its binding ability in a functional ELISA. Immobilized TNFRSF18 at 2 ?g/ml can bind TNFSF18 (CSB-MP891791HU), the EC50 is 2.565 to 2.940 ng/ml.?Human TNFRSF18 protein hFc tag (CSB-MP896537HU) captured on COOH chip can bind Human TNFSF18 protein hFc and Flag tag (CSB-MP891791HU) with an affinity constant of 38.5 nM as detected by LSPR Assay.
Purity:Greater than 94% as determined by SDS-PAGE.
Endotoxin:Less than 1.0 EU/ug as determined by LAL method.
Form:Lyophilized powder
Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:
Relevance:
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link: