
Size:100ug. Other sizes are also available. Please contact us.
Research Areas:Cancer
Uniprot NO.:O43557
Uniprot Entry Name:
Gene Names:TNFSF14
Species:Homo sapiens (Human)
Source:Mammalian cell
Expression Region:74-240aa
Sequence:DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Protein Description:Partial
Tag Info:N-terminal hFC-Myc-tagged
Mol. Weight:46.7 kDa
Biological_Activity:?Measured by its binding ability in a functional ELISA. Immobilized TNFRSF14 (CSB-MP842173HU) at 5 ?g/ml can bind TNFSF14, the EC50 is 45.44-53.29 ng/ml.
Purity:Greater than 85% as determined by SDS-PAGE.
Endotoxin:Less than 1.0 EU/ug as determined by LAL method.
Form:Lyophilized powder
Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:(Herpes virus entry mediator ligand)(HVEM-L)(Herpesvirus entry mediator ligand)(CD258)(HVEML)(LIGHT)(UNQ391)(PRO726)
Relevance:Cytokine that binds to TNFRSF3/LTBR. Binding to the decoy receptor TNFRSF6B modulates its effects. Acts as a ligand for TNFRSF14/HVEM (PubMed:9462508, PubMed:10754304). Upon binding to TNFRSF14/HVEM, delivers costimulatory signals to T cells, leading to T cell proliferation and IFNG production (PubMed:10754304).
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
You may also like
-
Recombinant Human Tumor necrosis factor ligand superfamily member 14(TNFSF14),partial,Biotinylated (Active)
- Regular price
- $631.00 USD
- Sale price
- $631.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Tumor necrosis factor receptor superfamily member 14(TNFRSF14) ,partial (Active)
- Regular price
- $370.00 USD
- Sale price
- $370.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Tumor necrosis factor ligand superfamily member 14(TNFSF14)
- Regular price
- $1,336.00 USD
- Sale price
- $1,336.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Tumor necrosis factor ligand superfamily member 9(TNFSF9),partial (Active)
- Regular price
- $390.00 USD
- Sale price
- $390.00 USD
- Regular price
-
- Unit price
- per
Sold out