Recombinant Human Trypsin-2(PRSS2)(K23Q,S167G),partial

Recombinant Human Trypsin-2(PRSS2)(K23Q,S167G),partial

CSB-EP018814HU(M)e0
Regular price
$525.00 USD
Sale price
$525.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Cell Biology

Uniprot ID:P07478

Gene Names:PRSS2

Organism:Homo sapiens (Human)

AA Sequence:APFDDDDQIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLGQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS

Expression Region:16-247aa(K23Q,S167G)

Sequence Info:Partial

Source:E.coli

Tag Info:N-terminal GST-tagged

MW:52.4 kDa

Alternative Name(s):Trypsin-2(EC 3.4.21.4)(Anionic trypsinogen)(Serine protease 2)(Trypsin II)

Relevance:In the ileum, may be involved in defensin processing, including DEFA5.

Reference:"Paneth cell trypsin is the processing enzyme for human defensin-5." Ghosh D., Porter E., Shen B., Lee S.K., Wilk D., Drazba J., Yadav S.P., Crabb J.W., Ganz T., Bevins C.L. Nat. Immunol. 3:583-590(2002)

Purity:Greater than 90% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:13-23 business days

Your list is ready to share