Recombinant Human Tissue factor(F3),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Tissue factor(F3),partial

CSB-EP007928HU1
Regular price
$600.00 USD
Sale price
$600.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Cardiovascular

Uniprot ID: P13726

Gene Names: F3

Organism: Homo sapiens (Human)

AA Sequence: SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE

Expression Region: 33-251aa

Sequence Info: Extracellular Domain

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 40.8 kDa

Alternative Name(s): Coagulation factor IIIThromboplastin; CD142

Relevance: Initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The [TF:VIIa] complex activates factors IX or X by specific limited protolysis. TF plays a role in normal hostasis by initiating the cell-surface assbly and propagation of the coagulation protease cascade.

Reference: Human tissue factor cDNA sequence and chromosome localization of the gene.Scarpati E.M., Wen D., Broze G.J. Jr., Miletich J.P., Flandermeyer R.R., Siegel N.R., Sadler J.E.Biochemistry 26:5234-5238(1987)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Tissue factor(F3),partial
    Regular price
    $600.00 USD
    Sale price
    $600.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Coagulation factor VII(F7),partial
    Regular price
    $872.00 USD
    Sale price
    $872.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Coagulation factor XI(F11),partial
    Regular price
    $768.00 USD
    Sale price
    $768.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Butyrophilin subfamily 3 member A2(BTN3A2),partial
    Regular price
    $600.00 USD
    Sale price
    $600.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share