Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Others
Uniprot ID:Q86WD7
Gene Names:SERPINA9
Organism:Homo sapiens (Human)
AA Sequence:ANAPSAYPRPSSTKSTPASQVYSLNTDFAFRLYRRLVLETPSQNIFFSPVSVSTSLAMLSLGAHSVTKTQILQGLGFNLTHTPESAIHQGFQHLVHSLTVPSKDLTLKMGSALFVKKELQLQANFLGNVKRLYEAEVFSTDFSNPSIAQARINSHVKKKTQGKVVDIIQGLDLLTAMVLVNHIFFKAKWEKPFHPEYTRKNFPFLVGEQVTVHVPMMHQKEQFAFGVDTELNCFVLQMDYKGDAVAFFVLPSKGKMRQLEQALSARTLRKWSHSLQKRWIEVFIPRFSISASYNLETILPKMGIQNVFDKNADFSGIAKRDSLQVSKATHKAVLDVSEEGTEATAATTTKFIVRSKDGPSYFTVSFNRTFLMMITNKATDGILFLGKVENPTKS
Expression Region:24-417aa
Sequence Info:Full Length of Mature Protein
Source:Mammalian cell
Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW:49.1 kDa
Alternative Name(s):Centerin (Germinal center B-cell-expressed transcript 1 protein) (GCET1) (SERPINA11)
Relevance:Protease inhibitor that inhibits trypsin and trypsin-like serine proteases. Inhibits plasmin and thrombin with lower efficiency
Reference:"Two newly characterized germinal center B-cell-associated genes, GCET1 and GCET2, have differential expression in normal and neoplastic B cells." Pan Z., Shen Y., Du C., Zhou G., Rosenwald A., Staudt L.M., Greiner T.C., McKeithan T.W., Chan W.C. Am. J. Pathol. 163:135-144(2003)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:Protease inhibitor that inhibits trypsin and trypsin-like serine proteases (in vitro). Inhibits plasmin and thrombin with lower efficiency (in vitro).
Involvement in disease:
Subcellular Location:Isoform 1: Secreted, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm, SUBCELLULAR LOCATION: Isoform 3: Cytoplasm, SUBCELLULAR LOCATION: Isoform 4: Cytoplasm, SUBCELLULAR LOCATION: Isoform 5: Cytoplasm, SUBCELLULAR LOCATION: Isoform 6: Cytoplasm, SUBCELLULAR LOCATION: Isoform 7: Membrane, Single-pass type II membrane protein
Protein Families:Serpin family
Tissue Specificity:Highly expressed in normal germinal center (GC) B-cells and GC B-cell-derived malignancies.
Paythway:
HGNC Database Link:https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:15995
UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=317970
KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?hsa:327657
STRING Database Link:https://string-db.org/network/9606.ENSP00000337133
OMIM Database Link:https://www.omim.org/entry/615677615677615677
Lead Time Guidance:18-28 business days