
Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Signal Transduction
Uniprot ID:P84095
Gene Names:RHOG
Organism:Homo sapiens (Human)
AA Sequence:MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAGQEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPTPIKRGRSC
Expression Region:1-188aa
Sequence Info:Full Length
Source:E.coli
Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW:28.4 kDa
Alternative Name(s):Rho-related GTP-binding protein RhoG
Relevance:Required for the formation of membrane ruffles during macropinocytosis. Plays a role in cell migration and is required for the formation of cup-like structures during trans-endothelial migration of leukocytes. In case of Salmonella enterica infection, activated by SopB and ARHGEF26/SGEF, which induces cytoskeleton rearrangements and promotes bacterial entry.
Reference:"Ephexin4 and EphA2 mediate cell migration through a RhoG-dependent mechanism." Hiramoto-Yamaki N., Takeuchi S., Ueda S., Harada K., Fujimoto S., Negishi M., Katoh H. J. Cell Biol. 190:461-477(2010)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:3-7 business days
You may also like
-
Recombinant Enterobacteria phage P1 Recombinase cre(cre)
- Regular price
- $889.00 USD
- Sale price
- $889.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Epithelial cell adhesion molecule(Epcam),partial
- Regular price
- $2,124.00 USD
- Sale price
- $2,124.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Actin-like protein 8(ACTL8)
- Regular price
- $1,716.00 USD
- Sale price
- $1,716.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Developmentally-regulated GTP-binding protein 2(DRG2)
- Regular price
- $615.00 USD
- Sale price
- $615.00 USD
- Regular price
-
- Unit price
- per
Sold out