
Size:100ug. Other sizes are also available. Please contact us.
Research Areas:Signal Transduction
Uniprot NO.:Q9UGC6
Uniprot Entry Name:
Gene Names:RGS17
Species:Homo sapiens (Human)
Source:E.coli
Expression Region:1-210aa
Sequence:MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES
Protein Description:Full Length
Tag Info:N-terminal GST-tagged
Mol. Weight:51.4 kDa
Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized AQP1 at 2 ?g/ml can bind human RGS17, the EC50 of human RGS17 protein is 31.63-34.44 ?g/ml.
Purity:Greater than 85% as determined by SDS-PAGE.
Endotoxin:Not test.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:RGS17 (RGSZ2)
Relevance:Regulates G protein-coupled receptor signaling cascades, including signaling via muscarinic acetylcholine receptor CHRM2 and dopamine receptor DRD2. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Binds selectively to GNAZ and GNAI2 subunits, accelerates their GTPase activity and regulates their signaling activities. Negatively regulates mu-opioid receptor-mediated activation of the G-proteins.
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
You may also like
-
Recombinant Human Aquaporin-1(AQP1) (Active)
- Regular price
- $1,989.00 USD
- Sale price
- $1,989.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Mucin-16(MUC16),partial (Active)
- Regular price
- $448.00 USD
- Sale price
- $448.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Gastrin-releasing peptide(GRP)
- Regular price
- $587.00 USD
- Sale price
- $587.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human UL16-binding protein 1(ULBP1),Biotinylated (Active)
- Regular price
- $638.00 USD
- Sale price
- $638.00 USD
- Regular price
-
- Unit price
- per
Sold out