
Size:100ug. Other sizes are also available. Please contact us.
Research Areas:Tags & Cell Markers
Uniprot NO.:P40855
Uniprot Entry Name:
Gene Names:PEX19
Species:Homo sapiens (Human)
Source:E.coli
Expression Region:2-296aa
Sequence:AAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGASGEQC
Protein Description:Full Length of Mature Protein
Tag Info:N-terminal GST-tagged
Mol. Weight:59.3 kDa
Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized ABCD1 at 5 ?g/ml can bind human PEX19,the EC50 of human PEX19 protein is 22.96-33.00 ?g/ml.
Purity:Greater than 90% as determined by SDS-PAGE.
Endotoxin:Not test.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:33 kDa housekeeping protein Peroxin-19 Peroxisomal farnesylated protein
Relevance:Necessary for early peroxisomal biogenesis. Acts both as a cytosolic chaperone and as an import receptor for peroxisomal membrane proteins (PMPs). Binds and stabilizes newly synthesized PMPs in the cytoplasm by interacting with their hydrophobic membrane-spanning domains, and targets them to the peroxisome membrane by binding to the integral membrane protein PEX3. Excludes CDKN2A from the nucleus and prevents its interaction with MDM2, which results in active degradation of TP53.
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
You may also like
-
Recombinant Human Fibroblast growth factor 19(FGF19),partial(Active)
- Regular price
- $1,207.00 USD
- Sale price
- $1,207.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Peroxisomal biogenesis factor 3(PEX3),partial
- Regular price
- $702.00 USD
- Sale price
- $702.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Interleukin-19 protein(IL19) (Active)
- Regular price
- $2,016.00 USD
- Sale price
- $2,016.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human ATP-dependent RNA helicase DDX19B(DDX19B) (Active)
- Regular price
- $648.00 USD
- Sale price
- $648.00 USD
- Regular price
-
- Unit price
- per
Sold out