Recombinant Human Nucleosome assembly protein 1-like 4(NAP1L4)

Recombinant Human Nucleosome assembly protein 1-like 4(NAP1L4)

CSB-EP015444HU
Regular price
$616.00 USD
Sale price
$616.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Epigenetics and Nuclear Signaling

Uniprot ID:Q99733

Gene Names:NAP1L4

Organism:Homo sapiens (Human)

AA Sequence:ADHSFSDGVPSDSVEAAKNASNTEKLTDQVMQNPRVLAALQERLDNVPHTPSSYIETLPKAVKRRINALKQLQVRCAHIEAKFYEEVHDLERKYAALYQPLFDKRREFITGDVEPTDAESEWHSENEEEEKLAGDMKSKVVVTEKAAATAEEPDPKGIPEFWFTIFRNVDMLSELVQEYDEPILKHLQDIKVKFSDPGQPMSFVLEFHFEPNDYFTNSVLTKTYKMKSEPDKADPFSFEGPEIVDCDGCTIDWKKGKNVTVKTIKKKQKHKGRGTVRTITKQVPNESFFNFFNPLKASGDGESLDEDSEFTLASDFEIGHFFRERIVPRAVLYFTGEAIEDDDNFEEGEEGEEEELEGDEEGEDEDDAEINPKV

Expression Region:2-375aa

Sequence Info:Full Length of Mature Protein

Source:E.coli

Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW:50.1 kDa

Alternative Name(s):Nucleosome assembly protein 1-like 4(Nucleosome assembly protein 2)(NAP-2)

Relevance:Acts as histone chaperone in nucleosome assembly.

Reference:"Functional characterization of human nucleosome assembly protein-2 (NAP1L4) suggests a role as a histone chaperone." Rodriguez P., Munroe D., Prawitt D., Chu L.L., Bric E., Kim J., Reid L.H., Davies C., Nakagama H., Loebbert R., Winterpacht A., Petruzzi M.J., Higgins M.J., Nowak N., Evans G., Shows T., Weissman B.E., Zabel B., Housman D.E., Pelletier J. Genomics 44:253-265(1997)

Purity:Greater than 90% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:13-23 business days

You may also like

  • Recombinant Human Nuclear receptor subfamily 4 group A member 2(NR4A2)
    Regular price
    $876.00 USD
    Sale price
    $876.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human RNA exonuclease 4(REXO4)
    Regular price
    $698.00 USD
    Sale price
    $698.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Peptidyl-prolyl cis-trans isomerase-like 4(PPIL4)
    Regular price
    $603.00 USD
    Sale price
    $603.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human RNA exonuclease 4(REXO4)
    Regular price
    $698.00 USD
    Sale price
    $698.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share