
Size:1mg. Other sizes are also available. Please contact us.
Research Areas:Microbiology
Uniprot NO.:P0DTC2
Uniprot Entry Name:
Gene Names:S
Species:Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
Source:Mammalian cell
Expression Region:16-685aa (D614G)
Sequence:VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR
Protein Description:Partial
Tag Info:C-terminal 10xHis-tagged
Mol. Weight:77.8 kDa
Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1 (D614G) at 2 ?g/ml can bind human ACE2 (CSB-MP866317HU), the EC50 is 8.236-11.22 ng/ml.
Purity:Greater than 85% as determined by SDS-PAGE.
Endotoxin:Less than 1.0 EU/ug as determined by LAL method.
Form:Lyophilized powder
Buffer:Lyophilized from a 0.2 ?m filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:
Relevance:
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
You may also like
-
Recombinant Human Novel Coronavirus Spike glycoprotein(S),partial (Active)
- Regular price
- $4,366.00 USD
- Sale price
- $4,366.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Severe acute respiratory syndrome coronavirus 2 RNA-dependent RNA polymerase(NSP12)
- Regular price
- $864.00 USD
- Sale price
- $864.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rat Mannan-binding lectin serine protease 2(Masp2)
- Regular price
- $1,667.00 USD
- Sale price
- $1,667.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Sonchus yellow net virus Spike glycoprotein(G)
- Regular price
- $1,636.00 USD
- Sale price
- $1,636.00 USD
- Regular price
-
- Unit price
- per
Sold out