
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Neuroscience
Target / Protein: TIMP3
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: P35625
AA Sequence: HPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINA
Tag info: N-terminal 6xHis-tagged
Expression Region: 30-208aa
Protein length: Partial
MW: 24.8 kDa
Alternative Name(s): Protein MIG-5Tissue inhibitor of metalloproteinases 3 ;TIMP-3
Relevance: Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates th by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to rodeling stimuli. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, MMP-14 and MMP-15.
Reference: Structure and expression in breast tumors of human TIMP-3, a new member of the metalloproteinase inhibitor family.Uria J.A., Ferrando A.A., Velasco G., Freije J.M., Lopez-Otin C.Cancer Res. 54:2091-2094(1994)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Metalloproteinase inhibitor 3(TIMP3),partial
- Regular price
- $597.00 USD
- Sale price
- $597.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Metalloproteinase inhibitor 2(TIMP2),partial
- Regular price
- $597.00 USD
- Sale price
- $597.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Metalloproteinase inhibitor 4(TIMP4)
- Regular price
- $867.00 USD
- Sale price
- $867.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Metalloproteinase inhibitor 4(TIMP4)
- Regular price
- $597.00 USD
- Sale price
- $597.00 USD
- Regular price
-
- Unit price
- per
Sold out