
Size:100ug. Other sizes are also available. Please contact us.
Research Areas:Cancer
Uniprot NO.:P14174
Uniprot Entry Name:
Gene Names:MIF
Species:Homo sapiens (Human)
Source:Mammalian cell
Expression Region:2-115aa
Sequence:PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Protein Description:Full Length of Mature Protein
Tag Info:C-terminal hFc-tagged
Mol. Weight:41.3 kDa
Biological_Activity:?Measured by its binding ability in a functional ELISA. Immobilized MIF at 2 ?g/ml can bind Anti- MIF Rabbit Monoclonal Antibody?CSB-RA146975A0HU?, the EC50 is 49.61-69.45 ng/ml.
Purity:Greater than 90% as determined by SDS-PAGE.
Endotoxin:Less than 1.0 EU/ug as determined by LAL method.
Form:Lyophilized powder
Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:(MIF)(Glycosylation-inhibiting factor)(GIF)(L-dopachrome isomerase)(L-dopachrome tautomerase)(Phenylpyruvate tautomerase)
Relevance:Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity.
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
You may also like
-
Recombinant Human Macrophage migration inhibitory factor(MIF)
- Regular price
- $585.00 USD
- Sale price
- $585.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Macrophage migration inhibitory factor(Mif)
- Regular price
- $411.00 USD
- Sale price
- $411.00 USD
- Regular price
-
- Unit price
- per
Sold out -
MIF Antibody - Cat. #: CSB-PA06867A0Rb
- Regular price
- $356.00 USD
- Sale price
- $356.00 USD
- Regular price
-
- Unit price
- per
Sold out -
MIF Antibody, HRP conjugated - Cat. #: CSB-PA06867B0Rb
- Regular price
- $356.00 USD
- Sale price
- $356.00 USD
- Regular price
-
- Unit price
- per
Sold out