
Size:100ug. Other sizes are also available. Please contact us.
Research Areas:Cytokine
Uniprot NO.:P01374
Uniprot Entry Name:
Gene Names:LTA
Species:Homo sapiens (Human)
Source:Mammalian cell
Expression Region:35-205aa
Sequence:LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Protein Description:Full Length of Mature Protein
Tag Info:N-terminal 6xHis-tagged
Mol. Weight:20.8
Biological_Activity:?Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 ?g/ml can bind human TNFRSF1B (CSB-MP023978HU2), the EC50 is 1.632-2.699 ng/ml.?Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 ?g/ml can bind human TNFR1?CSB-MP023977HU1?, the EC50 of human LTA protein is 4.409-6.797 ng/ml.
Purity:Greater than 95% as determined by SDS-PAGE.
Endotoxin:Less than 1.0 EU/ug as determined by LAL method.
Form:Lyophilized powder
Buffer:Lyophilized from a 0.2 ?m filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:
Relevance:
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link: