
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: Metabolism
Target / Protein: IL15
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: P40933
AA Sequence: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Tag info: N-terminal 6xHis-tagged
Expression Region: 49-162aa
Protein length: Full Length of Mature Protein
MW: 16.8 kDa
Alternative Name(s):
Relevance: Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.
Reference: Cloning of a T cell growth factor that interacts with the beta chain of the interleukin-2 receptor.Grabstein K.H., Eisenman J., Shanebeck K., Rauch C., Srinivasan S., Fung V., Beers C., Richardson J., Schoenborn M.A., Ahdieh M., Johnson L., Alderson M.R., Watson J.D., Anderson D.M., Giri J.G.Science 264:965-968(1994)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Interleukin-15(IL15)
- Regular price
- $672.00 USD
- Sale price
- $672.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Interleukin-15(IL15)
- Regular price
- $602.00 USD
- Sale price
- $602.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Interleukin-2(IL2)
- Regular price
- $602.00 USD
- Sale price
- $602.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Interleukin-15 protein(IL15) (Active)
- Regular price
- $1,581.00 USD
- Sale price
- $1,581.00 USD
- Regular price
-
- Unit price
- per
Sold out