
Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Others
Uniprot ID:P05015
Gene Names:IFNA16
Organism:Homo sapiens (Human)
AA Sequence:CDLPQTHSLGNRRALILLAQMGRISHFSCLKDRYDFGFPQEVFDGNQFQKAQAISAFHEMIQQTFNLFSTKDSSAAWDETLLDKFYIELFQQLNDLEACVTQEVGVEEIALMNEDSILAVRKYFQRITLYLMGKKYSPCAWEVVRAEIMRSFSFSTNLQKGLRRKD
Expression Region:24-189aa
Sequence Info:Full Length of Mature Protein
Source:E.coli
Tag Info:N-terminal 6xHis-tagged
MW:23.4 kDa
Alternative Name(s):IFN-alpha-16;Interferon alpha-WA
Relevance:Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Reference:"Ligand-induced assembling of the type I interferon receptor on supported lipid bilayers." Lamken P., Lata S., Gavutis M., Piehler J. J Mol Biol 341:303-318(2004)
Purity:Greater than 90% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:3-7 business days
You may also like
-
IFNA16 Antibody - Cat. #: CSB-PA011036LA01HU
- Regular price
- $367.00 USD
- Sale price
- $367.00 USD
- Regular price
-
- Unit price
- per
Sold out -
IFNA16 Antibody, HRP conjugated - Cat. #: CSB-PA011036LB01HU
- Regular price
- $367.00 USD
- Sale price
- $367.00 USD
- Regular price
-
- Unit price
- per
Sold out -
IFNA16 Antibody, FITC conjugated - Cat. #: CSB-PA011036LC01HU
- Regular price
- $367.00 USD
- Sale price
- $367.00 USD
- Regular price
-
- Unit price
- per
Sold out -
IFNA16 Antibody, Biotin conjugated - Cat. #: CSB-PA011036LD01HU
- Regular price
- $367.00 USD
- Sale price
- $367.00 USD
- Regular price
-
- Unit price
- per
Sold out