Recombinant Human HLA class I histocompatibility antigen, alpha chain G protein(HLAG),partial

Recombinant Human HLA class I histocompatibility antigen, alpha chain G protein(HLAG),partial

CSB-EP010509HUa2
Regular price
$577.00 USD
Sale price
$577.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Immunology

Target / Protein: HLA-G

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: P17693

AA Sequence: GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 25-338aa

Protein length: Full Length of Mature Protein

MW: 51.6 kDa

Alternative Name(s): HLA G antigen;MHC class I antigen G

Relevance: Involved in the presentation of foreign antigens to the immune syst. Plays a role in maternal tolerance of the fetus by mediating protection from the deleterious effects of natural killer cells, cytotoxic T-lymphocytes, macrophages and mononuclear cells.

Reference: Homo sapiens 2,229,817bp genomic DNA of 6p21.3 HLA class I region.Shiina S., Tamiya G., Oka A., Inoko H.Disulfide bond-mediated dimerization of HLA-G on the cell surface.Boyson J.E., Erskine R., Whitman M.C., Chiu M., Lau J.M., Koopman L.A., Valter M.M., Angelisova P., Horejsi V., Strominger J.L.Proc. Natl. Acad. Sci. U.S.A. 99:16180-16185(2002)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share