
Size:100ug. Other sizes are also available. Please contact us.
Research Areas:Neuroscience
Uniprot NO.:P10912
Uniprot Entry Name:
Gene Names:GHR
Species:Homo sapiens (Human)
Source:Mammalian cell
Expression Region:27-264aa
Sequence:AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY
Protein Description:Partial
Tag Info:C-terminal mFc-Avi-tagged
Mol. Weight:56.6
Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized human GH1 (CSB-MP009407HU) at 2 ?g/ml can bind Biotinylated human GHR, the EC50 is 2.067-3.208 ng/ml.
Purity:Greater than 95% as determined by SDS-PAGE.
Endotoxin:Less than 1.0 EU/ug as determined by LAL method.
Form:Lyophilized powder
Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:
Relevance:
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
You may also like
-
Recombinant Human Growth hormone receptor(GHR),partial (Active)
- Regular price
- $448.00 USD
- Sale price
- $448.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Pro-neuregulin-1, membrane-bound isoform(NRG1),partial (Active)
- Regular price
- $382.00 USD
- Sale price
- $382.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human UL16-binding protein 1(ULBP1),Biotinylated (Active)
- Regular price
- $638.00 USD
- Sale price
- $638.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Fibroblast growth factor 4 protein(FGF4) (Active)
- Regular price
- $1,207.00 USD
- Sale price
- $1,207.00 USD
- Regular price
-
- Unit price
- per
Sold out