
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Neuroscience
Target / Protein: LGALS9
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: O00182
AA Sequence: MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
Tag info: N-terminal 6xHis-GST-tagged
Expression Region: 1-323aa
Protein length: Full length of Isoform 2
MW: 65.9 kDa
Alternative Name(s): Ecalectin;Tumor antigen HOM-HD-21
Relevance: Binds galactosides. Has high affinity for the Forssman pentasaccharide. May play a role in thymocyte-epithelial interactions relevant to the biology of the thymus. Inhibits cell proliferation. It is a ligand for HAVCR2/TIM3. Induces T-helper type 1 lymphocyte (Th1) death. Isoform Short acts as an eosinophil choattractant.
Reference: Human galectin-9 isoform full-length cDNA from gastric adenocarcinoma.Kato S. Human ecalectin, a variant of human galectin-9, is a novel eosinophil chemoattractant produced by T lymphocytes.Matsumoto R., Matsumoto H., Seki M., Hata M., Asano Y., Kanegasaki S., Stevens R.L., Hirashima M.J. Biol. Chem. 273:16976-16984(1998)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Galectin-9(LGALS9)
- Regular price
- $588.00 USD
- Sale price
- $588.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Galectin-9(LGALS9)
- Regular price
- $656.00 USD
- Sale price
- $656.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human E3 ubiquitin-protein ligase TRIM9(TRIM9)
- Regular price
- $588.00 USD
- Sale price
- $588.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Galectin-1 protein(LGALS1) (Active)
- Regular price
- $657.00 USD
- Sale price
- $657.00 USD
- Regular price
-
- Unit price
- per
Sold out