
Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Immunology
Uniprot ID:Q16610
Gene Names:ECM1
Organism:Homo sapiens (Human)
AA Sequence:HPPSPTRDECFARRAPYPNYDRDILTIDIGRVTPNLMGHLCGNQRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIWRDPALCCYLSPGDEQVNCFNINYLRNVALVSGDTENAKGQGEQGSTGGTNISSTSEPKEE
Expression Region:386-540aa
Sequence Info:Partial
Source:E.coli
Tag Info:N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
MW:52.4 kDa
Alternative Name(s):Extracellular matrix protein 1(Secretory component p85)
Relevance:Involved in endochondral bone formation as negative regulator of bone mineralization. Stimulates the proliferation of endothelial cells and promotes angiogenesis. Inhibits MMP9 proteolytic activity.
Reference:"Extracellular matrix protein 1 inhibits the activity of matrix metalloproteinase 9 through high-affinity protein/protein interactions." Fujimoto N., Terlizzi J., Aho S., Brittingham R., Fertala A., Oyama N., McGrath J.A., Uitto J. Exp. Dermatol. 15:300-307(2006)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:3-7 business days
You may also like
-
Recombinant Human T-cell immunoreceptor with Ig and ITIM domains(TIGIT),partial (Active)
- Regular price
- $446.00 USD
- Sale price
- $446.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Secreted and transmembrane protein 1(SECTM1),partial (Active)
- Regular price
- $446.00 USD
- Sale price
- $446.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Tumor necrosis factor receptor superfamily member 8(TNFRSF8),partial (Active)
- Regular price
- $397.00 USD
- Sale price
- $397.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human C-C motif chemokine 8 protein(CCL8) (Active)
- Regular price
- $1,254.00 USD
- Sale price
- $1,254.00 USD
- Regular price
-
- Unit price
- per
Sold out