Recombinant Human Excitatory amino acid transporter 1(SLC1A3),partial

Recombinant Human Excitatory amino acid transporter 1(SLC1A3),partial

CSB-EP021434HU
Regular price
$717.00 USD
Sale price
$717.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Neuroscience

Uniprot ID:P43003

Gene Names:SLC1A3

Organism:Homo sapiens (Human)

AA Sequence:HPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPG

Expression Region:146-236aa

Sequence Info:Partial

Source:E.coli

Tag Info:N-terminal 6xHis-KSI-tagged

MW:25.5 kDa

Alternative Name(s):Sodium-dependent glutamate/aspartate transporter 1;GLAST-1;Solute carrier family 1 member 3

Relevance:Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate (PubMed:7521911, PubMed:8123008, PubMed:20477940, PubMed:26690923, PubMed:28032905, PubMed:28424515). Functions as a symporter that transports one amino acid molecule together with two or three Na+ ions and one proton, in parallel with the counter-transport of one K+ ion (PubMed:20477940). Mediates Cl- flux that is not coupled to amino acid transport; this avoids the accumulation of negative charges due to aspartate and Na+ symport (PubMed:20477940). Plays a redundant role in the rapid removal of released glutamate from the synaptic cleft, which is essential for terminating the postsynaptic action of glutamate (By similarity).

Reference:"Caveolin-1 Sensitivity of Excitatory Amino Acid Transporters EAAT1, EAAT2, EAAT3, and EAAT4." Abousaab A., Warsi J., Elvira B., Lang F. J. Membr. Biol. 249:239-249(2016)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:3-7 business days

You may also like

  • SLC1A3 Antibody, Biotin conjugated - Cat. #: CSB-PA021434LD11HU
    Regular price
    $364.00 USD
    Sale price
    $364.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • SLC1A3 Antibody, Biotin conjugated - Cat. #: CSB-PA021434LD01HU
    Regular price
    $364.00 USD
    Sale price
    $364.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • SLC1A3 Antibody, HRP conjugated - Cat. #: CSB-PA021434LB11HU
    Regular price
    $364.00 USD
    Sale price
    $364.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • SLC1A3 Antibody, HRP conjugated - Cat. #: CSB-PA021434LB01HU
    Regular price
    $364.00 USD
    Sale price
    $364.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share