
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Metabolism
Uniprot ID: O00303
Gene Names: EIF3F
Organism: Homo sapiens (Human)
AA Sequence: MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDF
Expression Region: 1-323aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 60.7 kDa
Alternative Name(s): Deubiquitinating enzyme eIF3f (EC:3.4.19.12)
Relevance: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassbly and recycling of post-termination ribosomal complexes and subsequently prevents prature joining of the 40S and 60S ribosomal subunits prior to initiation.
Reference: Structure of cDNAs encoding human eukaryotic initiation factor 3 subunits. Possible roles in RNA binding and macromolecular assembly.Asano K., Vornlocher H.-P., Richter-Cook N.J., Merrick W.C., Hinnebusch A.G., Hershey J.W.B.J. Biol. Chem. 272:27042-27052(1997)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Eukaryotic translation initiation factor 3 subunit G(EIF3G)
- Regular price
- $586.00 USD
- Sale price
- $586.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Eukaryotic translation initiation factor 3 subunit K(EIF3K)
- Regular price
- $881.00 USD
- Sale price
- $881.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Eukaryotic translation initiation factor 3 subunit E(EIF3E)
- Regular price
- $750.00 USD
- Sale price
- $750.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Eukaryotic translation initiation factor 3 subunit M(EIF3M)
- Regular price
- $586.00 USD
- Sale price
- $586.00 USD
- Regular price
-
- Unit price
- per
Sold out