Recombinant Human Cytotoxic T-lymphocyte protein 4(CTLA4),partial (Active)

Recombinant Human Cytotoxic T-lymphocyte protein 4(CTLA4),partial (Active)

CSB-MP006163HU1
Regular price
$359.00 USD
Sale price
$359.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Cancer

Uniprot NO.:P16410

Uniprot Entry Name:

Gene Names:CTLA4

Species:Homo sapiens (Human)

Source:Mammalian cell

Expression Region:37-162aa

Sequence:AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDF

Protein Description:Partial

Tag Info:C-terminal hFc-tagged

Mol. Weight:42.5 kDa

Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized CD152 at 2 ?g/ml can bind Anti-CD152 rabbit monoclonal antibody(CSB-RA213310A0HU), the EC50 of human CD152 protein is 27.14-34.82 ng/ml.

Purity:Greater than 91% as determined by SDS-PAGE.

Endotoxin:Less than 1.0 EU/ug as determined by LAL method.

Form:Lyophilized powder

Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:Cytotoxic T-lymphocyte-associated antigen 4 (CTLA-4) (CD_antigen: CD152) (CD152)

Relevance:Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Your list is ready to share