Recombinant Human Cytochrome P450 11B2, mitochondrial(CYP11B2),partial

Recombinant Human Cytochrome P450 11B2, mitochondrial(CYP11B2),partial

CSB-EP006391HU
Regular price
$755.00 USD
Sale price
$755.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Cell Biology

Target / Protein: CYP11B2

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: P19099

AA Sequence: GTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 25-503

Protein length: Full Length of Mature Protein

MW: 71 kDa

Alternative Name(s): Aldosterone synthase (EC:1.14.15.4, EC:1.14.15.5) Short name: ALDOS Aldosterone-synthesizing enzyme CYPXIB2 Cytochrome P-450Aldo Cytochrome P-450C18 Steroid 18-hydroxylase

Relevance: Preferentially catalyzes the conversion of 11-deoxycorticosterone to aldosterone via corticosterone and 18-hydroxycorticosterone.

Reference: "Structural insights into aldosterone synthase substrate specificity and targeted inhibition."Strushkevich N., Gilep A.A., Shen L., Arrowsmith C.H., Edwards A.M., Usanov S.A., Park H.W.Mol. Endocrinol. 27:315-324(2013).

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Cytochrome P450 11B2, mitochondrial(CYP11B2)
    Regular price
    $857.00 USD
    Sale price
    $857.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Cytochrome P450 11B2, mitochondrial(CYP11B2)
    Regular price
    $755.00 USD
    Sale price
    $755.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Cytochrome P450 11B1, mitochondrial(CYP11B1)
    Regular price
    $755.00 USD
    Sale price
    $755.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Steroid 21-hydroxylase(CYP21A2)
    Regular price
    $590.00 USD
    Sale price
    $590.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share