
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q8IZ96
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDPEHAKPESSEAPSGNLKQPETAAALSLILGALACFIITQANESFITITSLEICIVVFF ILIYVLTLHHLLTYLHWPLLDLTNSIITAVFLSVVAILAMQEKKRRHLLYVGGSLCLTAV IVCCIDAFVVTTKMRTNLKRFLGVEVERKLSPAKDAYPETGPDAPQRPA
Protein Names:Recommended name: CKLF-like MARVEL transmembrane domain-containing protein 1 Alternative name(s): Chemokine-like factor superfamily member 1
Gene Names:Name:CMTM1 Synonyms:CKLFSF1
Expression Region:1-169
Sequence Info:full length protein
You may also like
-
Recombinant Human CKLF-like MARVEL transmembrane domain-containing protein 3(CMTM3)
- Regular price
- $1,295.00 USD
- Sale price
- $1,295.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human CKLF-like MARVEL transmembrane domain-containing protein 7(CMTM7)
- Regular price
- $1,289.00 USD
- Sale price
- $1,289.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human CKLF-like MARVEL transmembrane domain-containing protein 6(CMTM6)
- Regular price
- $1,296.00 USD
- Sale price
- $1,296.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human CKLF-like MARVEL transmembrane domain-containing protein 2(CMTM2)
- Regular price
- $1,354.00 USD
- Sale price
- $1,354.00 USD
- Regular price
-
- Unit price
- per
Sold out