Recombinant Human CD226 antigen(CD226),partial (Active)

Recombinant Human CD226 antigen(CD226),partial (Active)

CSB-MP618996HU
Regular price
$429.00 USD
Sale price
$429.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Immunology

Uniprot NO.:Q15762

Uniprot Entry Name:

Gene Names:CD226

Species:Homo sapiens (Human)

Source:Mammalian cell

Expression Region:19-247aa

Sequence:EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN

Protein Description:Partial

Tag Info:C-terminal hFc-Myc-tagged

Mol. Weight:56.1

Biological_Activity:FACS assay shows that Human CD226 can bind to 293F cell overexpressing human CD155.

Purity:Greater than 93% as determined by SDS-PAGE.

Endotoxin:Less than 1.0 EU/ug as determined by LAL method.

Form:Lyophilized powder

Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:

Relevance:

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

You may also like

  • Recombinant Human CD276 antigen(CD276),partial (Active)
    Regular price
    $382.00 USD
    Sale price
    $382.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Basigin(BSG),partial (Active)
    Regular price
    $448.00 USD
    Sale price
    $448.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human T-cell immunoreceptor with Ig and ITIM domains(TIGIT),partial (Active)
    Regular price
    $429.00 USD
    Sale price
    $429.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human T-cell antigen CD7(CD7),partial (Active)
    Regular price
    $429.00 USD
    Sale price
    $429.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share